1.67 Rating by CuteStat

It is a domain having org extension. It has a global traffic rank of #23983188 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, informaticsed.org is SAFE to browse.

PageSpeed Score
80
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 20
Daily Pageviews: 40

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 23,983,188
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

69.163.209.101

Hosted Country:

United States of America US

Location Latitude:

33.9302

Location Longitude:

-117.888
Informatics Education

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 10
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 69.163.209.101)


MDK : Michael Dominic K.

- mdk.org.pl

Michael Dominic K. is a software craftsman.

21,071,628 $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Wed, 20 May 2015 21:58:45 GMT
Server: Apache
Last-Modified: Tue, 12 Jan 2010 20:59:47 GMT
ETag: "1e61-47cfdef1bf6c0"
Accept-Ranges: bytes
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 2501
Content-Type: text/html

Domain Information

Domain Registrar: DropCatch.com 1498 LLC

Domain Nameserver Information

Host IP Address Country
ns1.dreamhost.com 162.159.26.14 United States of America United States of America
ns2.dreamhost.com 162.159.26.81 United States of America United States of America
ns3.dreamhost.com 162.159.27.84 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
informaticsed.org A 14399 IP: 69.163.209.101
informaticsed.org NS 14399 Target: ns3.dreamhost.com
informaticsed.org NS 14399 Target: ns1.dreamhost.com
informaticsed.org NS 14399 Target: ns2.dreamhost.com
informaticsed.org SOA 14399 MNAME: ns1.dreamhost.com
RNAME: hostmaster.dreamhost.com
Serial: 2014101500
Refresh: 19042
Retry: 1800
Expire: 1814400
Minimum TTL: 14400
informaticsed.org MX 14399 Target: mx2.balanced.homie.mail.dreamhost.com
informaticsed.org MX 14399 Target: mx1.balanced.homie.mail.dreamhost.com

Similarly Ranked Websites

403 Forbidden

- happymothersday2016wishesquotes.com
23,983,199 $ 8.95

Tampa Criminal Defense Attorney | DUI Lawyer in Tampa

- tampaflcriminaldefenselawyers.com

The Tampa criminal defense lawyer at The Law Office of Timothy Hessinger has more than 15 years of invaluable experience as a former state prosecutor. Call our team for powerful advocacy!

23,983,208 $ 8.95

GaussianWaves

- gaussianwaves.blogspot.com
23,983,249 $ 8.95

Bichos da Mata

- bichosdamata.com.br

Bichos da Mata é uma turminha super divertida que tratam da preservação do meio ambiente e da cultura brasileira. Coquinho (mico-leão-dourado), Leza (bicho preguiça-de-coleira), Felícia (onça-pintada), Psit (papagaio da cara-roxa), Fifi (tucano do bicho-verde) e Myrme (tamanduá-bandeira) são animais em extinç

23,983,257 $ 8.95

Somdech Preah Maha Ghosananda

- ghosananda.org
23,983,302 $ 8.95

Full WHOIS Lookup

WHOIS LIMIT EXCEEDED - SEE WWW.PIR.ORG/WHOIS FOR DETAILS